Recombinant Human Band 3/AE 1 Protein

Recombinant Human Band 3/AE 1 Protein
Artikelnummer
ASBPP-4225-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: P02730

Gene Name: SLC4A1

Expression System: Escherichia coli

Molecular Weight: 43.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Met11

End Site: Asp370

Coverage: 0.41

Isoelectric Point: 4.5

Core Sequence: MMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 69%, Pig - 63%, Cynomolgus monkey - 89%

Alternative gene names: AE1; DI; EPB3

Alternative protein names: Band 3 anion transport protein; Anion exchange protein 1; AE 1; Anion exchanger 1; Solute carrier family 4 member 1; CD antigen CD233

Protein name: solute carrier family 4 member 1 (Diego blood group)

Full length: 911 amino acids

Entry name: B3AT_HUMAN

CD Antigen: CD233

Product panel: CD Antigen
Mehr Informationen
Artikelnummer ASBPP-4225-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-4225-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 6521
Produktinformation (PDF)
×
MSDS (PDF)
×