Recombinant Human SNRPGP15 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A8MWD9

Gene Name: SNRPGP15

Expression System: Escherichia coli

Molecular Weight: 9.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Met1

End Site: Val76

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MSKAHPPELKKFTDKKFSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQKNIGMVEIRGNSIIMLEALERV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 95%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Putative small nuclear ribonucleoprotein G-like protein 15

Protein name: small nuclear ribonucleoprotein polypeptide G pseudogene 15

Full length: 76 amino acids

Entry name: RUXGL_HUMAN

• Artikelnummer: ASBPP-3355-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3355-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 100130932