Recombinant Human SOX17 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H6I2

Gene Name: SOX17

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Pro71

End Site: Arg150

Coverage: 0.20

Isoelectric Point: 11.5

Core Sequence: PMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQVKRLKR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 72%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Transcription factor SOX-17

Protein name: SRY-box transcription factor 17

Full length: 414 amino acids

Entry name: SOX17_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-391-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-391-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 64321