Recombinant Human SOX2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P48431

Gene Name: SOX2

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Pro11

End Site: Phe90

Coverage: 0.28

Isoelectric Point: 10.5

Core Sequence: PPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 75%, Pig - 98%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Transcription factor SOX-2

Protein name: SRY-box transcription factor 2

Full length: 317 amino acids

Entry name: SOX2_HUMAN

Product panel: Neurodegenerative Diseases Marker,IHC Pathology,Neuroscience Biomarkers,DNA binding & Chromatin

• Artikelnummer: ASBPP-299-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-299-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 6657