Recombinant Human SOX8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P57073

Gene Name: SOX8

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Ala121

End Site: Thr230

Coverage: 0.27

Isoelectric Point: 9.5

Core Sequence: ADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQTHGPPTPPTT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 67%, Pig - 90%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Transcription factor SOX-8

Protein name: SRY-box transcription factor 8

Full length: 446 amino acids

Entry name: SOX8_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-322-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-322-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 30812