Note: Dry Ice fees will be extra-charged
Uniprot: Q13501
Gene Name: SQSTM1
Expression System: Escherichia coli
Molecular Weight: 11 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 80%
Start Site: Gly241
End Site: Gly320
Coverage: 0.21
Isoelectric Point: 5.5
Core Sequence: GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEG
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 79%, Pig - 84%, Cynomolgus monkey - 97%
Alternative gene names: ORCA; OSIL
Alternative protein names: Sequestosome-1; EBI3-associated protein of 60 kDa; EBIAP; p60; Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; Ubiquitin-binding protein p62
Protein name: sequestosome 1
Full length: 440 amino acids
Entry name: SQSTM_HUMAN
Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers
Deutsch
English
