Recombinant Human SRPK2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P78362

Gene Name: SRPK2

Expression System: Escherichia coli

Molecular Weight: 59.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Pro321

End Site: Gly460

Coverage: 0.22

Isoelectric Point: 4

Core Sequence: PEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%

Alternative gene names: /

Alternative protein names: SRSF protein kinase 2; SFRS protein kinase 2; Serine/arginine-rich protein-specific kinase 2; SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal]

Protein name: SRSF protein kinase 2

Full length: 688 amino acids

Entry name: SRPK2_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• Artikelnummer: ASBPP-3322-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3322-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6733