Recombinant Human STEAP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHE8

Gene Name: STEAP1

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Glu11

End Site: Gln70

Coverage: 0.21

Isoelectric Point: 6.5

Core Sequence: EELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Pig - 79%, Cynomolgus monkey - 99%

Alternative gene names: PRSS24; STEAP

Alternative protein names: STEAP1 protein; Six-transmembrane epithelial antigen of prostate 1

Protein name: STEAP family member 1

Full length: 339 amino acids

Entry name: STEA1_HUMAN

• Artikelnummer: ASBPP-3054-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3054-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 26872