Recombinant Human STK4 Protein

Recombinant Human STK4 Protein
Artikelnummer
ASBPP-412-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13043

Gene Name: STK4

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Lys301

End Site: Lys480

Coverage: 0.40

Isoelectric Point: 4.5

Core Sequence: KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 56%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: KRS2; MST1

Alternative protein names: Serine/threonine-protein kinase 4; Mammalian STE20-like protein kinase 1; MST-1; STE20-like kinase MST1; Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit; MST1/N; Serine/threonine-protein kinase 4 18kDa subunit; MST1/C]

Protein name: serine/threonine kinase 4

Full length: 487 amino acids

Entry name: STK4_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
Mehr Informationen
Artikelnummer ASBPP-412-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-412-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 6789
Produktinformation (PDF)
×
MSDS (PDF)
×