Recombinant Human SVIP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NHG7

Gene Name: SVIP

Expression System: Escherichia coli

Molecular Weight: 9.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Met1

End Site: Ser77

Coverage: 1.00

Isoelectric Point: 9

Core Sequence: MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 82%, Pig - 91%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Small VCP/p97-interacting protein

Protein name: small VCP interacting protein

Full length: 77 amino acids

Entry name: SVIP_HUMAN

• Artikelnummer: ASBPP-3356-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3356-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 258010