Recombinant Human SYNPO2L Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H987

Gene Name: SYNPO2L

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Arg261

End Site: Ser400

Coverage: 0.16

Isoelectric Point: 8.5

Core Sequence: RAESLQEKSIKEAKTKCRTIASLLTAAPNPHSKGVLMFKKRRQRAKKYTLVSFGAAAGTGAEEEDGVPPTSESELDEEAFSDARSLTNQSDWDSPYLDMELARAGSRASEGQGSGLGGQLSEVSGRGVQLFEQQRQRADS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 45%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Synaptopodin 2-like protein

Protein name: synaptopodin 2 like

Full length: 977 amino acids

Entry name: SYP2L_HUMAN

• Artikelnummer: ASBPP-4200-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4200-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 79933