Recombinant Human SYT9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86SS6

Gene Name: SYT9

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Tyr101

End Site: Asn210

Coverage: 0.24

Isoelectric Point: 5

Core Sequence: YMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 94%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Synaptotagmin-9; Synaptotagmin IX; SytIX

Protein name: synaptotagmin 9

Full length: 491 amino acids

Entry name: SYT9_HUMAN

• Artikelnummer: ASBPP-3036-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3036-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 143425