Recombinant Human TAC4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86UU9

Gene Name: TAC4

Expression System: HEK293

Molecular Weight: 53 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 48%

Start Site: Glu31

End Site: Gln110

Coverage: 0.82

Isoelectric Point: 5.5

Core Sequence: EAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 48%, Rat - 49%, Pig - 61%

Alternative gene names: /

Alternative protein names: Tachykinin-4; Preprotachykinin-C; PPT-C) [Cleaved into: Endokinin-A; EKA; Endokinin-A/B; EKA/B; Endokinin-C; EKC]

Protein name: tachykinin precursor 4

Full length: 113 amino acids

Entry name: TKN4_HUMAN

• Artikelnummer: ASBPQ-3330-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PQ-3330-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 255061