Recombinant Human TMEM200A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86VY9

Gene Name: TMEM200A

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Asp301

End Site: Asn480

Coverage: 0.39

Isoelectric Point: 8.5

Core Sequence: DEPSIDNITEDADNLKSRSRNLSMDSLVVPLPNTSESFQPVSTVLPRNNSIGESLSSQYKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWPRLDRNNSKGYMKLENKEDPMDRLLVPQVAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%

Alternative gene names: KIAA1913

Alternative protein names: Transmembrane protein 200A

Protein name: transmembrane protein 200A

Full length: 491 amino acids

Entry name: T200A_HUMAN

• Artikelnummer: ASBPP-3306-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3306-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 114801