Recombinant Human TMEM209 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96SK2

Gene Name: TMEM209

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Lys191

End Site: Ser310

Coverage: 0.22

Isoelectric Point: 8

Core Sequence: KLASFSPSPPSPYPTTVGPVESSGLRSRYRSSPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLGSPDSTSPSSSPTFWNYSRSMGDYAQTLKKFQYQLACRSQAPCANKDEADLS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 94%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Transmembrane protein 209

Protein name: transmembrane protein 209

Full length: 561 amino acids

Entry name: TM209_HUMAN

• Artikelnummer: ASBPP-3636-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3636-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 84928