Recombinant Human TMEM247 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A6NEH6

Gene Name: TMEM247

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Ala11

End Site: Phe160

Coverage: 0.75

Isoelectric Point: 5.5

Core Sequence: ARGAGESCPTFPKMVPGDSKSEGKPRAYLEAESQKPDSSYDYLEEMEACEDGGCQGPLKSLSPKSCRATKGQAGDGPKPAELPPTPGTERNPEMELEKVRMEFELTRLKYLHEKNQRQRQHEVVMEQLQRERQHEVVMEQLQQEAAPRLF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Pig - 73%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Transmembrane protein 247

Protein name: transmembrane protein 247

Full length: 219 amino acids

Entry name: TM247_HUMAN

• Artikelnummer: ASBPP-3329-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3329-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 388946