Recombinant Human TMEM72 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A0PK05

Gene Name: TMEM72

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Glu141

End Site: Pro260

Coverage: 0.47

Isoelectric Point: 6.5

Core Sequence: EVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Pig - 85%, Cynomolgus monkey - 98%

Alternative gene names: C10orf127; KSP37

Alternative protein names: Transmembrane protein 72; Kidney-specific secretory protein of 37 kDa

Protein name: transmembrane protein 72

Full length: 275 amino acids

Entry name: TMM72_HUMAN

• Artikelnummer: ASBPP-4222-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4222-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 643236