Recombinant Human TNFRSF4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P43489

Gene Name: TNFRSF4

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Cys141

End Site: Pro210

Coverage: 0.32

Isoelectric Point: 7

Core Sequence: CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 62%, Pig - 75%, Cynomolgus monkey - 95%

Alternative gene names: TXGP1L

Alternative protein names: Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134

Protein name: TNF receptor superfamily member 4

Full length: 277 amino acids

Entry name: TNR4_HUMAN

CD Antigen: CD134

Product panel: CD Antigen,DNA binding & Chromatin

• Artikelnummer: ASBPP-294-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-294-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 7293