Recombinant Human TNNC2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P02585

Gene Name: TNNC2

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Gln160

Coverage: 1.00

Isoelectric Point: 4

Core Sequence: MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 53%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Troponin C; skeletal muscle

Protein name: troponin C2, fast skeletal type

Full length: 160 amino acids

Entry name: TNNC2_HUMAN

• Artikelnummer: ASBPP-4075-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4075-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 7125