Recombinant Human TNNI2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P48788

Gene Name: TNNI2

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Glu31

End Site: Asp160

Coverage: 0.75

Isoelectric Point: 7.5

Core Sequence: EKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 97%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Troponin I; fast skeletal muscle; Troponin I; fast-twitch isoform

Protein name: troponin I2, fast skeletal type

Full length: 182 amino acids

Entry name: TNNI2_HUMAN

• Artikelnummer: ASBPP-4074-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4074-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 7136