Recombinant Human TNXB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P22105

Gene Name: TNXB

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 35%

Start Site: Glu1881

End Site: Glu1970

Coverage: 0.02

Isoelectric Point: 5

Core Sequence: EPHLGELTVEEATSHTLHLSWMVTEGEFDSFEIQYTDRDGQLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 35%, Pig - 74%, Cynomolgus monkey - 92%

Alternative gene names: HXBL; TNX; TNXB1; TNXB2; XB

Alternative protein names: Tenascin-X; TN-X; Hexabrachion-like protein

Protein name: tenascin XB

Full length: 4244 amino acids

Entry name: TENX_HUMAN

• Artikelnummer: ASBPP-1536-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-1536-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 7148