Recombinant Human TOE1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96GM8

Gene Name: TOE1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Asp301

End Site: Lys400

Coverage: 0.22

Isoelectric Point: 8

Core Sequence: DNFSAYGWCPLGPQCPQSHDIDLIIDTDEAAAEDKRRRRRRREKRKRALLNLPGTQTSGEAKDGPPKKQVCGDSIKPEETEQEVAADETRNLPHSKQGNK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Pig - 74%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Target of EGR1 protein 1

Protein name: target of EGR1, exonuclease

Full length: 510 amino acids

Entry name: TOE1_HUMAN

• Artikelnummer: ASBPP-3531-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3531-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 114034