Note: Dry Ice fees will be extra-charged
Uniprot: P11387
Gene Name: TOP1
Expression System: Escherichia coli
Molecular Weight: 26.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 97%
Start Site: Glu221
End Site: Ile420
Coverage: 0.28
Isoelectric Point: 10
Core Sequence: EHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 100%
Alternative gene names: /
Alternative protein names: DNA topoisomerase 1; DNA topoisomerase I
Protein name: DNA topoisomerase I
Full length: 765 amino acids
Entry name: TOP1_HUMAN
Product panel: Autoimmune Disease,DNA binding & Chromatin,Enzyme