Recombinant Human TPMT Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P51580

Gene Name: TPMT

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Met1

End Site: Lys245

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 79%

Alternative gene names: /

Alternative protein names: Thiopurine S-methyltransferase; Thiopurine methyltransferase

Protein name: thiopurine S-methyltransferase

Full length: 245 amino acids

Entry name: TPMT_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3952-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3952-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 7172