Recombinant Human TRAF3IP3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y228

Gene Name: TRAF3IP3

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Leu221

End Site: Ser500

Coverage: 0.51

Isoelectric Point: 5.5

Core Sequence: LLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKLQGADSRDLQMNQALRFLENEHQQLQAKIECLQGDRDLCSLDTQDLQDQLKRSEAEKLTLVTRVQQLQGLLQNQSLQLQEQEKLLTKKDQALPVWSPKSFPNEVEPEGTGKEKDWDLRDQLQKKTLQLQAKEKECRELHSELDNLSDEYLS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 32%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: T3JAM

Alternative protein names: TRAF3-interacting JNK-activating modulator; TRAF3-interacting protein 3

Protein name: TRAF3 interacting protein 3

Full length: 551 amino acids

Entry name: T3JAM_HUMAN

• Artikelnummer: ASBPP-4287-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4287-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 80342