Recombinant Human TRDC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: B7Z8K6

Gene Name: TRDC

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Arg31

End Site: Thr100

Coverage: 0.53

Isoelectric Point: 7

Core Sequence: RINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKET

Homologies: Highest protein sequence identity to the following orthologs: Pig - 71%, Cynomolgus monkey - 84%

Alternative gene names: /

Alternative protein names: T cell receptor delta constant

Protein name: T cell receptor delta constant

Full length: 153 amino acids

Entry name: TRDC_HUMAN

• Artikelnummer: ASBPP-3049-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3049-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 28526