Recombinant Human TRPM2 Protein

Recombinant Human TRPM2 Protein
Artikelnummer
ASBPP-3525-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: O94759

Gene Name: TRPM2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Asn1131

End Site: Lys1230

Coverage: 0.07

Isoelectric Point: 5

Core Sequence: NYLQNRQFQQKQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTAQALHWIVRTLRASGFSSEADVPTLASQKAAEEPDAEPGGRKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 70%, Pig - 70%, Cynomolgus monkey - 93%

Alternative gene names: EREG1; KNP3; LTRPC2; TRPC7

Alternative protein names: Transient receptor potential cation channel subfamily M member 2; Estrogen-responsive element-associated gene 1 protein; Long transient receptor potential channel 2; LTrpC-2; LTrpC2; Transient receptor potential channel 7; TrpC7; Transient receptor potential melastatin 2

Protein name: transient receptor potential cation channel subfamily M member 2

Full length: 1503 amino acids

Entry name: TRPM2_HUMAN

Product panel: Neuroscience Biomarkers
Mehr Informationen
Artikelnummer ASBPP-3525-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-3525-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 7226
Produktinformation (PDF)
×
MSDS (PDF)
×