Recombinant Human TSPAN10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H1Z9

Gene Name: TSPAN10

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Ala191

End Site: Gly330

Coverage: 0.44

Isoelectric Point: 6.5

Core Sequence: AHYQDDPDLRFLLDQVQLGLRCCGAASYQDWQQNLYFNCSSPGVQACSLPASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIAVVLLQGAELLLAARLLGALAARSGAAYGPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 38%, Pig - 72%, Cynomolgus monkey - 90%

Alternative gene names: OCSP

Alternative protein names: Tetraspanin-10; Tspan-10; Oculospanin

Protein name: tetraspanin 10

Full length: 355 amino acids

Entry name: TSN10_HUMAN

• Artikelnummer: ASBPP-3638-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3638-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 83882