Recombinant Human VTA1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NP79

Gene Name: VTA1

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Met1

End Site: Glu307

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALKLLTTGRE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: C6orf55

Alternative protein names: Vacuolar protein sorting-associated protein VTA1 homolog; Dopamine-responsive gene 1 protein; DRG-1; LYST-interacting protein 5; LIP5; SKD1-binding protein 1; SBP1

Protein name: vesicle trafficking 1

Full length: 307 amino acids

Entry name: VTA1_HUMAN

• Artikelnummer: ASBPP-3830-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3830-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 51534