Recombinant Human VXN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TAG6

Gene Name: VXN

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Glu11

End Site: Lys100

Coverage: 0.46

Isoelectric Point: 11

Core Sequence: ENIEVFTTVIPSKVSSPARRRAKSSQHLLTKNVVIESDLYTHQPLELLPHRGDRRDPGDRRRFGRLQTARPPTAHPAKASARPVGISEPK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Pig - 78%, Cynomolgus monkey - 97%

Alternative gene names: C8orf46

Alternative protein names: Vexin

Protein name: vexin

Full length: 207 amino acids

Entry name: VEXIN_HUMAN

• Artikelnummer: ASBPP-3618-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3618-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 254778