Recombinant Human WDR36 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NI36

Gene Name: WDR36

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Leu661

End Site: Ser760

Coverage: 0.11

Isoelectric Point: 4

Core Sequence: LLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPES

Homologies: Highest protein sequence identity to the following orthologs: Pig - 91%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: WD repeat-containing protein 36; T-cell activation WD repeat-containing protein; TA-WDRP

Protein name: WD repeat domain 36

Full length: 951 amino acids

Entry name: WDR36_HUMAN

• Artikelnummer: ASBPP-3340-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3340-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 134430