Recombinant Human ZFP41 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N8Y5

Gene Name: ZFP41

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Thr11

End Site: Val130

Coverage: 0.66

Isoelectric Point: 9

Core Sequence: TPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQCGKAFRHSSDV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 58%, Pig - 59%, Cynomolgus monkey - 80%

Alternative gene names: /

Alternative protein names: Zinc finger protein 41 homolog; Zfp-41

Protein name: ZFP41 zinc finger protein

Full length: 198 amino acids

Entry name: ZFP41_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3407-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3407-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 286128