Recombinant Human ZNF107 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UII5

Gene Name: ZNF107

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Cys641

End Site: Tyr720

Coverage: 0.12

Isoelectric Point: 9

Core Sequence: CGKAFNCSSTLNRHKIIHTGEKPYKCKECGKAFNLSSTLTAHKKIHTGEKPYKCEECGKAFNQSSNLTTHKKIHTSEKPY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 67%, Pig - 73%, Cynomolgus monkey - 100%

Alternative gene names: ZFD25; ZNF588

Alternative protein names: Zinc finger protein 107; Zinc finger protein 588; Zinc finger protein ZFD25

Protein name: zinc finger protein 107

Full length: 783 amino acids

Entry name: ZN107_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3564-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3564-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 51427