Recombinant Human ZNF131 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P52739

Gene Name: ZNF131

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu141

End Site: Val250

Coverage: 0.19

Isoelectric Point: 4.5

Core Sequence: EAKKRKIAETSNVITESLPSAESEPVEIEVEIAEGTIEVEDEGIETLEEVASAKQSVKYIQSTGSSDDSALALLADITSKYRQGDRKGQIKEDGCPSDPTSKQVEGIEIV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 131

Protein name: zinc finger protein 131

Full length: 623 amino acids

Entry name: ZN131_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-10457-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10457-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 7690