Recombinant Human ZNF28 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P17035

Gene Name: ZNF28

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala111

End Site: Asn190

Coverage: 0.12

Isoelectric Point: 7

Core Sequence: APMTEIKELTGSTGQHDQRHAGNKHIKDQLGLSFHSHLPELHIFQPEGKIGNQVEKSINNASSVSTSQRICCRPKTHISN

Homologies: Highest protein sequence identity to the following orthologs: Pig - 38%, Cynomolgus monkey - 83%

Alternative gene names: KOX24

Alternative protein names: Zinc finger protein 28; Zinc finger protein KOX24

Protein name: zinc finger protein 28

Full length: 718 amino acids

Entry name: ZNF28_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3372-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3372-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 7576