Recombinant Human ZNF341 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BYN7

Gene Name: ZNF341

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Lys321

End Site: Gly430

Coverage: 0.13

Isoelectric Point: 8.5

Core Sequence: KLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFAQKSNVKKHMQTHKVWPPGHSGGTVSRNSVTVQVMALNPSRQEDEESTGLGQPLPGAPQPQALSTAGEEEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Rat - 57%, Pig - 92%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Zinc finger protein 341

Protein name: zinc finger protein 341

Full length: 854 amino acids

Entry name: ZN341_HUMAN

Product panel: E3 Ligase,DNA binding & Chromatin

• Artikelnummer: ASBPP-3425-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3425-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 84905