Recombinant Human ZNF430 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H8G1

Gene Name: ZNF430

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Leu11

End Site: Glu160

Coverage: 0.28

Isoelectric Point: 6.5

Core Sequence: LKEASGCPGADRNLLVYSFYEKGPLTFRDVAIEFSLEEWQCLDTAQQDLYRKVMLENYRNLVFLAGIAVSKPDLITCLEQGKEPWNMKRHAMVDQPPVTYSHFAQDLWPEQGIKDSFQEVILRRYGKCGHEDLQLRTGCKSVDECNLHKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 39%, Pig - 59%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Zinc finger protein 430

Protein name: zinc finger protein 430

Full length: 570 amino acids

Entry name: ZN430_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3432-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3432-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 80264