Recombinant Human ZNF674 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q2M3X9

Gene Name: ZNF674

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 55%

Start Site: Lys11

End Site: Gly120

Coverage: 0.20

Isoelectric Point: 4.5

Core Sequence: KDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGHLVGKPDVIFRLGPGDESWMADGGTPVRTCAGEDRPEVWEVDEQIDHYKESQDKFLWQAAFIGKETLKDESG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 55%, Rat - 46%, Pig - 61%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 674

Protein name: zinc finger protein 674

Full length: 581 amino acids

Entry name: ZN674_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3566-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3566-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 641339