Recombinant Human ZNF688 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P0C7X2

Gene Name: ZNF688

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu111

End Site: Arg190

Coverage: 0.30

Isoelectric Point: 8.5

Core Sequence: EEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGR

Homologies: Highest protein sequence identity to the following orthologs: Pig - 63%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 688

Protein name: zinc finger protein 688

Full length: 276 amino acids

Entry name: ZN688_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3447-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3447-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 146542