Recombinant Human ZNF701 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NV72

Gene Name: ZNF701

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu171

End Site: Gln270

Coverage: 0.20

Isoelectric Point: 10.5

Core Sequence: ETNGHEALMTKTKKLMSSTERHDQRHAGNKPIKNELGSSFHSHLPEVHIFHPEGKIGNQVEKAINDAFSVSASQRISCRPKTRISNKYRNNFLQSSLLTQ

Homologies: Highest protein sequence identity to the following orthologs: Pig - 29%, Cynomolgus monkey - 80%

Alternative gene names: /

Alternative protein names: Zinc finger protein 701

Protein name: zinc finger protein 701

Full length: 531 amino acids

Entry name: ZN701_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3633-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3633-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 55762