Recombinant Human ZNF723 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P0DPD5

Gene Name: ZNF723

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Ser211

End Site: Thr280

Coverage: 0.15

Isoelectric Point: 9

Core Sequence: SVPSKLNNHKRIHTGEKPYKCEECGKAFNVSSSLNNHKRIHTGEKPYKCEECGKTFNMFSSLNNHKRIHT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 66%, Pig - 71%, Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: Zinc finger protein 723

Protein name: zinc finger protein 723

Full length: 513 amino acids

Entry name: ZN723_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3571-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3571-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 646864