Recombinant Human ZNF786 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N393

Gene Name: ZNF786

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala271

End Site: Ala360

Coverage: 0.12

Isoelectric Point: 7.5

Core Sequence: ADGEMCFRHELTHPSHRLPQQGEKPAQCTPCGKRSLPVDSTQARRCQHSREGPASWREGRGASSSVHSGQKPGSRLPQEGNSHQEGDTEA

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: Zinc finger protein 786

Protein name: zinc finger protein 786

Full length: 782 amino acids

Entry name: ZN786_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3501-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3501-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 136051