Recombinant Human ZNF804B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A4D1E1

Gene Name: ZNF804B

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Lys841

End Site: Glu1050

Coverage: 0.16

Isoelectric Point: 8

Core Sequence: KKPPNCQGTQHDRLDSYSIEKMYYLNKSKRNQESLGSPHICDLGKVRPMKCNSGNISCLLKNCSSGPSETTESNTAEGERTPLTAKILLERVQAKKCQEQSSNVEISSNSCKSELEAPSQVPCTIQLAPSGCNRQALPLSEKIQYASESRNDQDSAIPRTTEKDKSKSSHTNNFTILADTDCDNHLSKGIIHLVTESQSLNIKRDATTKE

Homologies: Highest protein sequence identity to the following orthologs: Pig - 65%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 804B

Protein name: zinc finger protein 804B

Full length: 1349 amino acids

Entry name: Z804B_HUMAN

• Artikelnummer: ASBPP-4283-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4283-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 219578