Recombinant Human ZNF813 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZN06

Gene Name: ZNF813

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala111

End Site: Ile180

Coverage: 0.13

Isoelectric Point: 9.5

Core Sequence: APMTEIKKLTGSADRYDQRHAGNKPIKDQLGSSFHSHLPELHMFQTQGKIGNQVEKSINDASSISTSQRI

Homologies: Highest protein sequence identity to the following orthologs: Pig - 38%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Zinc finger protein 813

Protein name: zinc finger protein 813

Full length: 617 amino acids

Entry name: ZN813_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3397-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3397-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 126017