Recombinant Human ZNF845 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96IR2

Gene Name: ZNF845

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala111

End Site: Lys190

Coverage: 0.08

Isoelectric Point: 10

Core Sequence: APMTEIKQLTGSTNRHDQRHAGNKPIKDQLGSSFHSHLPELHMFQTEGKIGNQVEKSINSASLVSTSQRISCRPKTHISK

Homologies: Highest protein sequence identity to the following orthologs: Pig - 38%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Zinc finger protein 845

Protein name: zinc finger protein 845

Full length: 970 amino acids

Entry name: ZN845_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3548-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3548-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 91664