Recombinant Human ZNF850 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A8MQ14

Gene Name: ZNF850

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Tyr421

End Site: Leu520

Coverage: 0.09

Isoelectric Point: 9

Core Sequence: YDCKECGKSFTAGSTLIQHQRIHTGEKPYDCKECGKSFASGSALLQHQRIHTGEKPYCCKECGKSFTFRSTRNRHQRIHTGEKPYNCKECGKSFASGSAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 65%, Pig - 75%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 850

Protein name: zinc finger protein 850

Full length: 1090 amino acids

Entry name: ZN850_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3385-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3385-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 342892