Recombinant Human ZNF860 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A6NHJ4

Gene Name: ZNF860

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Arg121

End Site: Leu190

Coverage: 0.13

Isoelectric Point: 10.5

Core Sequence: RNSHEATMTQIKKLTGSTDRYDRRHPGNKPIKDQLGLSFHSHLPELHIFQTKGKVGNQVEKSINDASSVL

Homologies: Highest protein sequence identity to the following orthologs: Pig - 51%, Cynomolgus monkey - 82%

Alternative gene names: /

Alternative protein names: Zinc finger protein 860

Protein name: zinc finger protein 860

Full length: 632 amino acids

Entry name: ZN860_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3524-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3524-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 344787