Research Areas: Immunology
Uniprot: P34884
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 10xHis-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 18.4 kDa
Gene Names: Mif
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 2-115aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Endotoxin: Not test.
Relevance: Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity, but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Reference: "Purification, bioactivity, and secondary structure analysis of mouse and human macrophage migration inhibitory factor (MIF)."Bernhagen J., Mitchell R.A., Calandra T., Voelter W., Cerami A., Bucala R.Biochemistry 33:14144-14155(1994)
Deutsch
English
