Research Areas: Others
Uniprot: Q90WA1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 14.1 kDa
Gene Names: N/A
Organism: Pseudonaja textilis textilis (Eastern brown snake)
Source: E.coli
Expression Region: 25-83aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: KDRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCAA
Endotoxin: Not test.
Relevance: Strongly inhibits plasmin (Ki=0.44 nM) and trypsin (Ki=0.42 nM). Has little effect on plasma (Ki=1870 nM) and tissue (Ki=12900 nM) kallikreins. In vivo, reduces bleeding in a small animal model.
Reference: "Textilinin-1, an alternative anti-bleeding agent to aprotinin: importance of plasmin inhibition in controlling blood loss."Flight S.M., Johnson L.A., Du Q.S., Warner R.L., Trabi M., Gaffney P.J., Lavin M.F., de Jersey J., Masci P.P.Br. J. Haematol. 145:207-211(2009)
Deutsch
English
