Research Areas: Epigenetics and Nuclear Signaling
Uniprot: P02879
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 37.4 kDa
Gene Names: N/A
Organism: Ricinus communis (Castor bean)
Source: E.coli
Expression Region: 36-302aa
Protein Length: Partial
Target Protein Sequence: IFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQF
Endotoxin: Not test.
Relevance: Ricin is highly toxic to animal cells, and to a lesser extent to plant cells.; [Ricin A chain]: Acts as a glycosidase that removes a specific adenine residue from an exposed loop of the 28S rRNA (A4324 in mammals), leading to rRNA breakage. As this loop is involved in elongation factor binding, modified ribosomes are catalytically inactive and unable to support protein synthesis. Can inactivate a few thousand ribosomes per minute, faster than the cell can make new ones. Therefore a single molecule can kill an animal cell.; [Ricin B chain]: Binds to beta-D-galactopyranoside moieties on cell surface glycoproteins and glycolipids and facilitates the entry into the cell of the A chain. Also responsible for cell agglutination (Lectin activity).
Reference: "Structural analyses of sugar chains from ricin A-chain variant."Kimura Y., Kusuoku H., Tada M., Takagi S., Funatsu G.Agric. Biol. Chem. 54:157-162(1990)
Deutsch
English
